34 last week
91 last month
8,499 active domains
6,202 domains with DNS records
Domains from 42 countries
8,495 domains with RDAP and WHOIS records
Includes 1,565 unique IPs hosting active domains
A metric that estimates network influence and trust, based on the link structure of domains using .financial TLD
The average PageRank score reflecting the SEO authority of websites with the .financial TLD
| TLD | Domain | TLD suffix | Country | IP address | Technologies | PR value | Harmonic value | Detected hosts count | DNS last data checked | DNS Status | DNS records | RDAP/WHOIS last data checked | RDAP/WHOIS method | Domain creation date | Domain expiration date | Domain last changed | Registrar | RDAP/WHOIS Record |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| financial | atomic.financial | financial | United States (US) | 75.2.60.5 | ["Envoy Proxy", "Cloudflare"] | 0.00000012028 | 14,651,990.00 | 2026/01/08 | 1 | {"A": ["75.2.60.5"], "MX": [{"host": ... | 2025/06/30 | RDAP | 2020/06/09 | 2026/06/09 | 2025/06/30 | Gandi SAS | {"raw_response": ... | |
| financial | asa.financial | financial | United States (US) | 13.107.246.53 | ["Google Tag Manager", "Apache HTTP S... | 0.00000006013 | 17,696,592.00 | 2026/01/04 | 1 | {"A": ["13.107.246.53", "13.107.213.5... | 2025/09/08 | RDAP | 2019/09/04 | 2026/09/04 | 2025/09/08 | GoDaddy.com, LLC | {"raw_response": ... | |
| financial | sv88.financial | financial | United States (US) | 104.21.50.135 | ["AdBlock"] | 0.00000004144 | 17,711,436.00 | 2026/01/08 | 1 | {"A": ["104.21.50.135", "172.67.206.1... | 2025/12/12 | RDAP | 2024/01/10 | 2026/01/10 | 2025/12/12 | Dynadot Inc | {"raw_response": ... | |
| financial | bet88.financial | financial | United States (US) | 188.114.97.3 | ["WordPress", "PHP", "Cloudflare"] | 0.00000003841 | 17,693,028.00 | 2025/12/31 | 1 | {"A": ["188.114.97.3", "188.114.96.3"... | 2025/09/09 | RDAP | 2024/10/05 | 2025/10/05 | 2025/09/09 | GoDaddy.com, LLC | {"raw_response": ... | |
| financial | bk8.financial | financial | United States (US) | 188.114.97.3 | ["WordPress", "PHP", "Cloudflare"] | 0.00000003841 | 17,693,028.00 | 2025/12/31 | 1 | {"A": ["188.114.97.3", "188.114.96.3"... | 2025/08/22 | RDAP | 2024/07/24 | 2026/07/24 | 2025/08/22 | GoDaddy.com, LLC | {"raw_response": ... | |
| financial | swap.financial | financial | United States (US) | 13.248.155.104 | ["Google Tag Manager"] | 0.00000003413 | 14,041,505.00 | 2026/01/13 | 1 | {"A": ["13.248.155.104", "76.223.27.1... | 2025/06/21 | RDAP | 2020/07/02 | 2026/07/02 | 2025/06/21 | Amazon Registrar, Inc. | {"raw_response": ... | |
| financial | breathe.financial | financial | United States (US) | 192.0.78.252 | ["NGINX"] | 0.00000003350 | 8,180,014.50 | 2026/01/11 | 1 | {"A": ["192.0.78.252", "192.0.78.153"... | 2025/08/28 | RDAP | 2024/09/06 | 2026/09/06 | 2025/08/28 | Automattic Inc. | {"raw_response": ... | |
| financial | una.financial | financial | United States (US) | 104.18.10.145 | ["Cloudflare"] | 0.00000003266 | 13,933,087.00 | 2026/01/13 | 1 | {"A": ["104.18.10.145", "104.18.11.14... | 2025/08/18 | RDAP | 2020/08/07 | 2027/08/07 | 2025/08/18 | GoDaddy.com, LLC | {"raw_response": ... | |
| financial | steakhouse.financial | financial | United States (US) | 216.198.79.193 | ["Google Tag Manager"] | 0.00000003171 | 14,652,483.00 | 2026/01/08 | 1 | {"A": ["216.198.79.193"], "MX": [{"ho... | 2025/08/21 | RDAP | 2022/04/26 | 2026/04/26 | 2025/08/21 | OVH SAS | {"raw_response": ... | |
| financial | alphacapital.financial | financial | United States (US) | 188.114.97.3 | ["Vercel", "Cloudflare"] | 0.00000002809 | 14,693,234.00 | 2026/01/13 | 1 | {"A": ["188.114.97.3", "188.114.96.3"... | 2025/09/30 | RDAP | 2021/10/29 | 2025/10/29 | 2024/01/01 | NameCheap, Inc. | {"raw_response": ... | |
| financial | merge.financial | financial | United States (US) | 76.223.54.146 | ["OpenResty"] | 0.00000002215 | 9,585,497.00 | 2025/12/28 | 1 | {"A": ["76.223.54.146", "13.248.169.4... | 2025/10/25 | RDAP | 2025/10/02 | 2026/10/02 | 2025/10/25 | Dynadot Inc | {"raw_response": ... | |
| financial | spero.financial | financial | United States (US) | 104.20.34.220 | ["Google Tag Manager", "WordPress", "... | 0.00000002060 | 15,309,903.00 | 2026/01/08 | 1 | {"A": ["104.20.34.220", "172.66.144.1... | 2025/06/24 | RDAP | 2020/01/20 | 2028/01/20 | 2025/06/24 | Cloudflare, Inc | {"raw_response": ... | |
| financial | vera.financial | financial | United States (US) | 52.36.8.69 | ["NGINX"] | 0.00000001892 | 14,429,333.00 | 2025/12/30 | 1 | {"A": ["52.36.8.69"], "MX": [{"host":... | 2025/07/28 | RDAP | 2021/02/15 | 2026/02/15 | 2025/07/28 | NameCheap, Inc. | {"raw_response": ... | |
| financial | cu.financial | financial | United States (US) | 72.44.80.241 | ["Google Tag Manager", "WordPress", "... | 0.00000001806 | 14,595,790.00 | 2026/01/04 | 1 | {"A": ["72.44.80.241"], "MX": [{"host... | 2025/06/25 | RDAP | 2020/12/18 | 2026/12/18 | 2025/06/24 | GoDaddy.com, LLC | {"raw_response": ... | |
| financial | pando.financial | financial | France (FR) | 217.70.184.38 | ["NGINX"] | 0.00000001749 | 13,309,560.00 | 2025/12/29 | 1 | {"A": ["217.70.184.38"], "MX": [{"hos... | 2025/06/27 | RDAP | 2025/03/12 | 2026/03/12 | 2025/06/27 | Gandi SAS | {"raw_response": ... | |
| financial | crater.financial | financial | United States (US) | 76.76.21.21 | ["Nuxt.js", "Vercel"] | 0.00000001652 | 13,564,958.00 | 2026/01/09 | 1 | {"A": ["76.76.21.21"], "MX": [{"host"... | 2025/08/22 | RDAP | 2022/07/30 | 2026/07/30 | 2025/08/22 | Squarespace Domains II LLC | {"raw_response": ... | |
| financial | integrity.financial | financial | United States (US) | 167.71.150.99 | ["Google Tag Manager", "Gravatar", "N... | 0.00000001635 | 14,596,971.00 | 2026/01/03 | 1 | {"A": ["167.71.150.99"], "MX": [{"hos... | 2025/07/13 | RDAP | 2016/02/17 | 2026/02/17 | 2025/07/13 | GoDaddy.com, LLC | {"raw_response": ... | |
| financial | sunwin.financial | financial | United States (US) | 104.21.51.82 | ["AdBlock"] | 0.00000001604 | 13,848,327.00 | 2026/01/08 | 1 | {"A": ["104.21.51.82", "172.67.177.14... | 2025/11/06 | RDAP | 2023/12/05 | 2026/12/05 | 2025/11/06 | Dynadot Inc | {"raw_response": ... | |
| financial | premierprivatewealth.financial | financial | United States (US) | 149.28.37.95 | ["Google Tag Manager", "Apache HTTP S... | 0.00000001509 | 14,618,674.00 | 2026/01/08 | 1 | {"A": ["149.28.37.95"], "NS": ["ns63.... | 2025/07/13 | RDAP | 2023/04/26 | 2026/04/26 | 2025/07/13 | GoDaddy.com, LLC | {"raw_response": ... | |
| financial | 69vn.financial | financial | United States (US) | 188.114.96.3 | ["WordPress", "Cloudflare"] | 0.00000001447 | 13,697,507.00 | 2025/12/29 | 1 | {"A": ["188.114.96.3", "188.114.97.3"... | 2025/06/20 | RDAP | 2025/04/01 | 2026/04/01 | 2025/06/20 | Spaceship, Inc. | {"raw_response": ... | |
| financial | pryme.financial | financial | United States (US) | 216.239.32.21 | ["Google Tag Manager"] | 0.00000001411 | 14,951,578.00 | 2026/01/06 | 1 | {"A": ["216.239.32.21", "216.239.34.2... | 2025/06/18 | RDAP | 2022/04/22 | 2026/04/22 | 2025/06/18 | Squarespace Domains II LLC | {"raw_response": ... | |
| financial | edgestone.financial | financial | United States (US) | 3.161.82.124 | ["Amazon CloudFront", "Facebook"] | 0.00000001384 | 13,039,610.00 | 2026/01/14 | 1 | {"A": ["3.161.82.124", "3.161.82.3", ... | 2025/08/17 | RDAP | 2021/04/15 | 2026/04/15 | 2025/08/17 | PDR Ltd. d/b/a PublicDomainRegistry.com | {"raw_response": ... | |
| financial | morrison.financial | financial | United States (US) | 198.49.23.145 | ["Apache HTTP Server", "WordPress", "... | 0.00000001309 | 6,180,940.50 | 2026/01/10 | 1 | {"A": ["198.49.23.145"], "MX": [{"hos... | 2025/09/09 | RDAP | 2021/09/16 | 2025/09/16 | 2025/09/09 | Squarespace Domains II LLC | {"raw_response": ... | |
| financial | pussy.financial | financial | United States (US) | 76.76.21.21 | ["Vercel"] | 0.00000001207 | 13,719,583.00 | 2026/01/11 | 1 | {"A": ["76.76.21.21"], "MX": [{"host"... | 2025/07/10 | RDAP | 2021/04/20 | 2026/04/20 | 2025/07/10 | Tucows Domains Inc. | {"raw_response": ... | |
| financial | jhc.financial | financial | United States (US) | 13.248.169.48 | ["OpenResty"] | 0.00000001172 | 13,288,187.00 | 2025/12/31 | 1 | {"A": ["13.248.169.48", "76.223.54.14... | 2025/11/02 | RDAP | 2024/12/01 | 2025/12/01 | 2025/11/01 | Sav.com, LLC - 32 | {"raw_response": ... |
The largest database of live domains and detailed information about them, designed to boost your digital strategies.
| TLD suffix | Count Domain | Percentage of TLD suffix |
|---|---|---|
| .financial | 8,498 | 99.99 |
| .co.financial | 1 | 0.01 |
| Technology | Count Domain | Percentage of Technology |
|---|---|---|
| OpenResty | 1,635 | 25.10 |
| Cloudflare | 776 | 11.91 |
| Google Tag Manager | 645 | 9.90 |
| NGINX | 590 | 9.06 |
| Apache HTTP Server | 565 | 8.67 |
| PHP | 553 | 8.49 |
| AdBlock | 356 | 5.46 |
| WordPress | 334 | 5.13 |
| Google Analytics | 189 | 2.90 |
| Google reCAPTCHA | 89 | 1.37 |
| Envoy Proxy | 86 | 1.32 |
| LiteSpeed Web Server | 86 | 1.32 |
| Akamai | 79 | 1.21 |
| Amazon CloudFront | 68 | 1.04 |
| Squarespace | 62 | 0.95 |
| 54 | 0.83 | |
| Wix | 48 | 0.74 |
| Microsoft IIS | 39 | 0.60 |
| ASP.NET | 34 | 0.52 |
| Plesk | 34 | 0.52 |
| Gravatar | 33 | 0.51 |
| Vercel | 25 | 0.38 |
| Varnish Cache | 23 | 0.35 |
| WooCommerce | 18 | 0.28 |
| Laravel | 16 | 0.25 |
| Drupal | 13 | 0.20 |
| Google AdSense | 9 | 0.14 |
| LiveChat | 7 | 0.11 |
| Nuxt.js | 6 | 0.09 |
| Optimizely | 5 | 0.08 |
| Mailchimp | 5 | 0.08 |
| Pepyaka | 4 | 0.06 |
| Sucuri | 4 | 0.06 |
| New Relic | 3 | 0.05 |
| Stripe | 3 | 0.05 |
| amazon | 2 | 0.03 |
| Weebly | 2 | 0.03 |
| Lighttpd | 2 | 0.03 |
| Shopify | 2 | 0.03 |
| Sitefinity | 2 | 0.03 |
| TYPO3 | 2 | 0.03 |
| [] | 1 | 0.02 |
| Cornerstone OnDemand | 1 | 0.02 |
| Bitrix CMS | 1 | 0.02 |
| Jimdo | 1 | 0.02 |
| Joomla | 1 | 0.02 |
| Piwik (Matomo) | 1 | 0.02 |
| Zend Framework | 1 | 0.02 |
| Country | Count Domain | Percentage of Country |
|---|---|---|
| United States (US) | 5,033 | 81.32 |
| Germany (DE) | 326 | 5.27 |
| British Virgin Islands (VG) | 148 | 2.39 |
| France (FR) | 143 | 2.31 |
| Canada (CA) | 119 | 1.92 |
| United Kingdom (GB) | 102 | 1.65 |
| Finland (FI) | 78 | 1.26 |
| Australia (AU) | 40 | 0.65 |
| Italy (IT) | 39 | 0.63 |
| Netherlands (NL) | 32 | 0.52 |
| Lithuania (LT) | 18 | 0.29 |
| Denmark (DK) | 11 | 0.18 |
| Switzerland (CH) | 11 | 0.18 |
| Japan (JP) | 10 | 0.16 |
| Singapore (SG) | 9 | 0.15 |
| Ireland (IE) | 8 | 0.13 |
| Austria (AT) | 7 | 0.11 |
| Russia (RU) | 6 | 0.10 |
| Czech Republic (CZ) | 5 | 0.08 |
| Poland (PL) | 4 | 0.06 |
| Sweden (SE) | 4 | 0.06 |
| Ukraine (UA) | 4 | 0.06 |
| Hong Kong (HK) | 3 | 0.05 |
| South Africa (ZA) | 3 | 0.05 |
| Spain (ES) | 3 | 0.05 |
| Belgium (BE) | 2 | 0.03 |
| Brazil (BR) | 2 | 0.03 |
| India (IN) | 2 | 0.03 |
| Luxembourg (LU) | 2 | 0.03 |
| Malaysia (MY) | 2 | 0.03 |
| Norway (NO) | 2 | 0.03 |
| Argentina (AR) | 1 | 0.02 |
| Cyprus (CY) | 1 | 0.02 |
| Estonia (EE) | 1 | 0.02 |
| Hungary (HU) | 1 | 0.02 |
| Israel (IL) | 1 | 0.02 |
| Mexico (MX) | 1 | 0.02 |
| New Zealand (NZ) | 1 | 0.02 |
| Portugal (PT) | 1 | 0.02 |
| Slovakia (SK) | 1 | 0.02 |
| South Korea (KR) | 1 | 0.02 |
| Taiwan (TW) | 1 | 0.02 |
The .financial top-level domain (TLD) designates online identities focused on finance, banking, investment, and professional advisory services. Within our global index, we track .financial domains and .financial websites to map real-world usage and risk signals. Current activity shows 8,499 active registrations, with 6,202 resolving via DNS and 6,202 live sites delivering content or services. Adoption spans 42 countries, reflecting cross-border relevance for firms and practitioners seeking descriptive, industry-aligned naming. In comparative analyses, .financial provides clear intent signaling and keyword matching without reliance on legacy namespaces, aiding discoverability and categorization. We continuously normalize WHOIS, DNS, and web telemetry to monitor churn, hosting shifts, and compliance footprints. Download .financial domain datasets from webatla.
Introduced under ICANN’s new gTLD program in the mid‑2010s, .financial was designed as a generic, sector-specific namespace rather than a restricted community domain. In practice, .financial domains benefit from semantic precision, while registrants typically apply standard registrar security options such as DNSSEC and privacy, depending on providers. We observe fresh activity signals: 34 new registrations last week and 91 in December 2025, indicating steady but selective growth. Across .financial websites, we analyze naming patterns, host geography, and redirect behavior to quantify brand use versus defensive holdings. This lens helps benchmark availability, lifecycle stages, and consolidation around major platforms. Download time-series .financial domain datasets from webatla.
Organizations choose .financial to state purpose clearly – banks, insurers, wealth managers, fintech vendors, comparison portals, and specialist publishers. We evaluate who adopts .financial domains by mapping registrant types, corporate linkages, and web stacks, then correlating outcomes across 42 markets. Signals from .financial websites – content responsiveness, TLS posture, and traffic-bearing versus parked states – align with 6,202 live implementations out of 8,499 active records, a practical proxy for utilization. Such clarity helps teams assess naming resonance, portfolio overlap, and migration risk relative to legacy TLDs. These data also surface regional partners and hosting preferences for regulated sectors. Download sector-tagged .financial domain datasets from webatla.
The largest database of live domains and detailed information about them, designed to boost your digital strategies.
Yes, you can view examples to see the file format and the amount of information provided. You can download them on the Pricing page, under each package.
All files are provided in CSV format. If you need a different format (XML, JSON, SQL), please contact our support team.
You need to make a purchase on our website. Once the payment is complete, you will receive a download link for the files in your selected package.
We only offer package solutions. You can check out our packages and pricing on the Pricing page.
