| TLD | Domain | TLD suffix | Country | IP address | Technologies | PR value | Harmonic value | Detected hosts count | DNS last data checked | DNS Status | DNS records | RDAP/WHOIS last data checked | RDAP/WHOIS method | Domain creation date | Domain expiration date | Domain last changed | Registrar | RDAP/WHOIS Record |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| financial | atomic.financial | financial | United States (US) | 75.2.60.5 | ["Envoy Proxy", "Cloudflare"] | 0.00000009181 | 14,415,854.00 | 2026/01/26 | 1 | {"A": ["75.2.60.5"], "MX": [{"host": ... | 2025/06/30 | RDAP | 2020/06/09 | 2026/06/09 | 2025/06/30 | Gandi SAS | {"raw_response": ... | |
| financial | spero.financial | financial | United States (US) | 172.66.144.113 | ["Google Tag Manager", "WordPress", "... | 0.00000005081 | 14,626,868.00 | 2026/01/26 | 1 | {"A": ["172.66.144.113", "104.20.34.2... | 2025/06/24 | RDAP | 2020/01/20 | 2028/01/20 | 2025/06/24 | Cloudflare, Inc | {"raw_response": ... | |
| financial | una.financial | financial | United States (US) | 104.18.11.145 | ["Cloudflare"] | 0.00000003745 | 13,564,672.00 | 2026/01/31 | 1 | {"A": ["104.18.11.145", "104.18.10.14... | 2025/08/18 | RDAP | 2020/08/07 | 2027/08/07 | 2025/08/18 | GoDaddy.com, LLC | {"raw_response": ... | |
| financial | vlxx.financial | financial | United States (US) | 104.21.87.151 | ["Cloudflare"] | 0.00000003740 | 17,407,902.00 | 2026/01/25 | 1 | {"A": ["104.21.87.151", "172.67.144.2... | 2025/08/19 | RDAP | 2025/07/24 | 2026/07/24 | 2025/08/19 | GoDaddy.com, LLC | {"raw_response": ... | |
| financial | sv88.financial | financial | United States (US) | 104.21.50.135 | ["AdBlock"] | 0.00000003703 | 17,407,954.00 | 2026/01/26 | 1 | {"A": ["104.21.50.135", "172.67.206.1... | 2025/12/12 | RDAP | 2024/01/10 | 2026/01/10 | 2025/12/12 | Dynadot Inc | {"raw_response": ... | |
| financial | bk8.financial | financial | United States (US) | 188.114.96.1 | ["WordPress", "PHP", "Cloudflare"] | 0.00000003666 | 17,407,892.00 | 2026/02/06 | 1 | {"A": ["188.114.96.1", "188.114.97.1"... | 2025/08/22 | RDAP | 2024/07/24 | 2026/07/24 | 2025/08/22 | GoDaddy.com, LLC | {"raw_response": ... | |
| financial | swap.financial | financial | United States (US) | 13.248.155.104 | ["Google Tag Manager"] | 0.00000003514 | 13,722,612.00 | 2026/01/13 | 1 | {"A": ["13.248.155.104", "76.223.27.1... | 2025/06/21 | RDAP | 2020/07/02 | 2026/07/02 | 2025/06/21 | Amazon Registrar, Inc. | {"raw_response": ... | |
| financial | breathe.financial | financial | United States (US) | 192.0.78.153 | ["NGINX"] | 0.00000003400 | 8,035,357.50 | 2026/01/29 | 1 | {"A": ["192.0.78.153", "192.0.78.252"... | 2025/08/28 | RDAP | 2024/09/06 | 2026/09/06 | 2025/08/28 | Automattic Inc. | {"raw_response": ... | |
| financial | alphacapital.financial | financial | United States (US) | 188.114.96.3 | ["Vercel", "Cloudflare"] | 0.00000002908 | 14,427,353.00 | 2026/01/31 | 1 | {"A": ["188.114.96.3", "188.114.97.3"... | 2025/09/30 | RDAP | 2021/10/29 | 2025/10/29 | 2024/01/01 | NameCheap, Inc. | {"raw_response": ... | |
| financial | steakhouse.financial | financial | United States (US) | 216.198.79.193 | ["Google Tag Manager"] | 0.00000002618 | 14,285,750.00 | 2026/01/27 | 1 | {"A": ["216.198.79.193"], "MX": [{"ho... | 2025/08/21 | RDAP | 2022/04/26 | 2026/04/26 | 2025/08/21 | OVH SAS | {"raw_response": ... | |
| financial | asa.financial | financial | United States (US) | 13.107.213.53 | ["Google Tag Manager", "Apache HTTP S... | 0.00000002535 | 13,542,684.00 | 2026/01/22 | 1 | {"A": ["13.107.213.53", "13.107.246.5... | 2025/09/08 | RDAP | 2019/09/04 | 2026/09/04 | 2025/09/08 | GoDaddy.com, LLC | {"raw_response": ... | |
| financial | vera.financial | financial | United States (US) | 52.36.8.69 | ["NGINX"] | 0.00000001871 | 13,522,833.00 | 2026/02/04 | 1 | {"A": ["52.36.8.69"], "MX": [{"host":... | 2026/01/17 | RDAP | 2021/02/15 | 2027/02/15 | 2026/01/17 | NameCheap, Inc. | {"raw_response": ... | |
| financial | crater.financial | financial | United States (US) | 76.76.21.21 | ["Nuxt.js", "Vercel"] | 0.00000001707 | 13,225,328.00 | 2026/01/27 | 1 | {"A": ["76.76.21.21"], "MX": [{"host"... | 2025/08/22 | RDAP | 2022/07/30 | 2026/07/30 | 2025/08/22 | Squarespace Domains II LLC | {"raw_response": ... | |
| financial | pando.financial | financial | France (FR) | 217.70.184.38 | ["NGINX"] | 0.00000001707 | 12,959,473.00 | 2026/01/16 | 1 | {"A": ["217.70.184.38"], "MX": [{"hos... | 2025/06/27 | RDAP | 2025/03/12 | 2026/03/12 | 2025/06/27 | Gandi SAS | {"raw_response": ... | |
| financial | delta.financial | financial | United States (US) | 188.114.96.1 | ["Vercel", "Cloudflare"] | 0.00000001614 | 14,437,776.00 | 2026/01/26 | 1 | {"A": ["188.114.96.1", "188.114.97.1"... | 2025/11/24 | RDAP | 2020/12/23 | 2026/12/23 | 2025/11/24 | NameCheap, Inc. | {"raw_response": ... | |
| financial | premierprivatewealth.financial | financial | United States (US) | 149.28.37.95 | ["Google Tag Manager", "Apache HTTP S... | 0.00000001543 | 14,300,108.00 | 2026/01/27 | 1 | {"A": ["149.28.37.95"], "NS": ["ns64.... | 2025/07/13 | RDAP | 2023/04/26 | 2026/04/26 | 2025/07/13 | GoDaddy.com, LLC | {"raw_response": ... | |
| financial | 69vn.financial | financial | United States (US) | 188.114.96.3 | ["WordPress", "Cloudflare"] | 0.00000001395 | 13,372,707.00 | 2026/02/03 | 1 | {"A": ["188.114.96.3", "188.114.97.3"... | 2025/06/20 | RDAP | 2025/04/01 | 2026/04/01 | 2025/06/20 | Spaceship, Inc. | {"raw_response": ... | |
| financial | morrison.financial | financial | United States (US) | 198.49.23.145 | ["Apache HTTP Server", "WordPress", "... | 0.00000001309 | 6,180,940.50 | 2026/01/28 | 1 | {"A": ["198.49.23.145"], "MX": [{"hos... | 2025/09/09 | RDAP | 2021/09/16 | 2025/09/16 | 2025/09/09 | Squarespace Domains II LLC | {"raw_response": ... | |
| financial | pussy.financial | financial | United States (US) | 76.76.21.21 | ["Vercel"] | 0.00000001242 | 13,377,033.00 | 2026/01/29 | 1 | {"A": ["76.76.21.21"], "MX": [{"host"... | 2025/07/10 | RDAP | 2021/04/20 | 2026/04/20 | 2025/07/10 | Tucows Domains Inc. | {"raw_response": ... | |
| financial | mjslot777.financial | financial | United States (US) | 5.161.230.87 | ["PHP", "Cloudflare"] | 0.00000001234 | 1.84 | 2026/02/02 | 1 | {"A": ["5.161.230.87", "46.62.237.138... | 2025/09/30 | RDAP | 2024/10/29 | 2025/10/29 | 2024/01/01 | NameCheap, Inc. | {"raw_response": ... | |
| financial | myneo.financial | financial | United States (US) | 18.208.85.101 | ["Google Tag Manager", "NGINX", "Clou... | 0.00000001216 | 11,142,270.00 | 2026/01/27 | 1 | {"A": ["18.208.85.101"], "NS": ["ns1.... | 2026/01/15 | RDAP | 2023/02/13 | 2027/02/13 | 2026/01/15 | Name.com, Inc. | {"raw_response": ... | |
| financial | comb.financial | financial | United States (US) | 188.114.96.1 | ["Vercel", "Cloudflare"] | 0.00000001176 | 14,275,890.00 | 2026/01/31 | 1 | {"A": ["188.114.96.1", "188.114.97.1"... | 2025/11/09 | RDAP | 2021/12/08 | 2026/12/08 | 2025/11/09 | NameCheap, Inc. | {"raw_response": ... | |
| financial | hercle.financial | financial | United States (US) | 3.164.206.113 | ["Google Tag Manager", "Amazon CloudF... | 0.00000001130 | 11,579,572.00 | 2026/02/14 | 1 | {"A": ["3.164.206.113", "3.164.206.66... | 2025/07/27 | RDAP | 2019/08/07 | 2026/08/07 | 2025/07/27 | Amazon Registrar, Inc. | {"raw_response": ... | |
| financial | nic.financial | financial | United States (US) | 75.2.38.108 | ["NGINX"] | 0.00000001096 | 14,274,627.00 | 2026/02/10 | 1 | {"A": ["75.2.38.108", "99.83.155.228"... | 2025/06/21 | RDAP | 2014/03/18 | 2026/03/18 | 2025/06/20 | Registry Operator acts as Registrar (... | {"raw_response": ... | |
| financial | clear.financial | financial | United States (US) | 185.230.63.186 | ["Wix"] | 0.00000001074 | 2.00 | 2026/02/04 | 1 | {"A": ["185.230.63.186", "185.230.63.... | 2026/02/12 | RDAP | 2014/08/03 | 2026/08/03 | 2026/02/12 | Go Canada Domains, LLC | {"raw_response": ... |
Download full list of .financial domains with tech detailed information
The largest database of live domains and detailed information about them, designed to boost your digital strategies.
.financial domains share by TLD suffix
| TLD suffix | Count Domain | Percentage of TLD suffix |
|---|---|---|
| .financial | 8,594 | 99.99 |
| .co.financial | 1 | 0.01 |
.financial domains share by technologies
| Technology | Count Domain | Percentage of Technology |
|---|---|---|
| OpenResty | 1,644 | 24.96 |
| Cloudflare | 790 | 12.00 |
| Google Tag Manager | 664 | 10.08 |
| NGINX | 590 | 8.96 |
| PHP | 566 | 8.59 |
| Apache HTTP Server | 561 | 8.52 |
| AdBlock | 352 | 5.34 |
| WordPress | 339 | 5.15 |
| Google Analytics | 194 | 2.95 |
| Google reCAPTCHA | 92 | 1.40 |
| Envoy Proxy | 90 | 1.37 |
| LiteSpeed Web Server | 87 | 1.32 |
| Akamai | 82 | 1.25 |
| Amazon CloudFront | 68 | 1.03 |
| Squarespace | 67 | 1.02 |
| 55 | 0.84 | |
| Wix | 48 | 0.73 |
| Microsoft IIS | 39 | 0.59 |
| ASP.NET | 34 | 0.52 |
| Gravatar | 33 | 0.50 |
| Plesk | 33 | 0.50 |
| Vercel | 25 | 0.38 |
| Varnish Cache | 23 | 0.35 |
| WooCommerce | 17 | 0.26 |
| Laravel | 16 | 0.24 |
| Drupal | 13 | 0.20 |
| Google AdSense | 8 | 0.12 |
| LiveChat | 7 | 0.11 |
| Optimizely | 6 | 0.09 |
| Nuxt.js | 6 | 0.09 |
| Mailchimp | 5 | 0.08 |
| Pepyaka | 4 | 0.06 |
| Sucuri | 4 | 0.06 |
| New Relic | 3 | 0.05 |
| Stripe | 3 | 0.05 |
| amazon | 2 | 0.03 |
| Weebly | 2 | 0.03 |
| Lighttpd | 2 | 0.03 |
| Shopify | 2 | 0.03 |
| Sitefinity | 2 | 0.03 |
| TYPO3 | 2 | 0.03 |
| Cornerstone OnDemand | 1 | 0.02 |
| Bitrix CMS | 1 | 0.02 |
| Jimdo | 1 | 0.02 |
| Joomla | 1 | 0.02 |
| Piwik (Matomo) | 1 | 0.02 |
| Zend Framework | 1 | 0.02 |
.financial domains share by countries
| Country | Count Domain | Percentage of Country |
|---|---|---|
| United States (US) | 5,034 | 81.01 |
| Germany (DE) | 342 | 5.50 |
| British Virgin Islands (VG) | 145 | 2.33 |
| France (FR) | 141 | 2.27 |
| Canada (CA) | 118 | 1.90 |
| United Kingdom (GB) | 107 | 1.72 |
| Finland (FI) | 74 | 1.19 |
| Australia (AU) | 40 | 0.64 |
| Italy (IT) | 39 | 0.63 |
| Netherlands (NL) | 35 | 0.56 |
| Lithuania (LT) | 19 | 0.31 |
| Japan (JP) | 13 | 0.21 |
| Denmark (DK) | 11 | 0.18 |
| Switzerland (CH) | 11 | 0.18 |
| Singapore (SG) | 9 | 0.14 |
| Ireland (IE) | 8 | 0.13 |
| Austria (AT) | 7 | 0.11 |
| Russia (RU) | 7 | 0.11 |
| Czech Republic (CZ) | 5 | 0.08 |
| Sweden (SE) | 5 | 0.08 |
| Hungary (HU) | 4 | 0.06 |
| Poland (PL) | 4 | 0.06 |
| South Africa (ZA) | 4 | 0.06 |
| Ukraine (UA) | 4 | 0.06 |
| Belgium (BE) | 3 | 0.05 |
| Hong Kong (HK) | 3 | 0.05 |
| Spain (ES) | 3 | 0.05 |
| Brazil (BR) | 2 | 0.03 |
| India (IN) | 2 | 0.03 |
| Luxembourg (LU) | 2 | 0.03 |
| Norway (NO) | 2 | 0.03 |
| Argentina (AR) | 1 | 0.02 |
| Cyprus (CY) | 1 | 0.02 |
| Estonia (EE) | 1 | 0.02 |
| Israel (IL) | 1 | 0.02 |
| Malaysia (MY) | 1 | 0.02 |
| Mexico (MX) | 1 | 0.02 |
| New Zealand (NZ) | 1 | 0.02 |
| Portugal (PT) | 1 | 0.02 |
| Slovakia (SK) | 1 | 0.02 |
| South Korea (KR) | 1 | 0.02 |
| Taiwan (TW) | 1 | 0.02 |