.financial domains list

Download structured datasets with verified DNS, RDAP & WHOIS, and technology fields for all .financial domains.
Access a complete list of .financial domains with active DNS records, WHOIS data, IPs, and detected technologies — all verified and updated daily.

Analytics overview of .financial domains in webatla

Access precise and up-to-date information on active domains and websites with the .financial TLD from the comprehensive webatla database.

New domain registrations

33 last week
139 last month

Active domains

8,595 active domains

DNS

6,225 domains with DNS records

Countries

Domains from 42 countries

RDAP and WHOIS

8,595 domains with RDAP and WHOIS records

IP addresses

Includes 1,564 unique IPs hosting active domains

Average Harmonic Value: 1,683,043.74

A metric that estimates network influence and trust, based on the link structure of domains using .financial TLD

Average PR Value: 0.00000000094

The average PageRank score reflecting the SEO authority of websites with the .financial TLD

Database preview of .financial domains

Preview the top .financial domains
Last updated: 2026-02-15
TLD Domain TLD suffix Country IP address Technologies PR value Harmonic value Detected hosts count DNS last data checked DNS Status DNS records RDAP/WHOIS last data checked RDAP/WHOIS method Domain creation date Domain expiration date Domain last changed Registrar RDAP/WHOIS Record
financial atomic.financial financial United States (US) 75.2.60.5 ["Envoy Proxy", "Cloudflare"] 0.00000009181 14,415,854.00 2026/01/26 1 {"A": ["75.2.60.5"], "MX": [{"host": ... 2025/06/30 RDAP 2020/06/09 2026/06/09 2025/06/30 Gandi SAS {"raw_response": ...
financial spero.financial financial United States (US) 172.66.144.113 ["Google Tag Manager", "WordPress", "... 0.00000005081 14,626,868.00 2026/01/26 1 {"A": ["172.66.144.113", "104.20.34.2... 2025/06/24 RDAP 2020/01/20 2028/01/20 2025/06/24 Cloudflare, Inc {"raw_response": ...
financial una.financial financial United States (US) 104.18.11.145 ["Cloudflare"] 0.00000003745 13,564,672.00 2026/01/31 1 {"A": ["104.18.11.145", "104.18.10.14... 2025/08/18 RDAP 2020/08/07 2027/08/07 2025/08/18 GoDaddy.com, LLC {"raw_response": ...
financial vlxx.financial financial United States (US) 104.21.87.151 ["Cloudflare"] 0.00000003740 17,407,902.00 2026/01/25 1 {"A": ["104.21.87.151", "172.67.144.2... 2025/08/19 RDAP 2025/07/24 2026/07/24 2025/08/19 GoDaddy.com, LLC {"raw_response": ...
financial sv88.financial financial United States (US) 104.21.50.135 ["AdBlock"] 0.00000003703 17,407,954.00 2026/01/26 1 {"A": ["104.21.50.135", "172.67.206.1... 2025/12/12 RDAP 2024/01/10 2026/01/10 2025/12/12 Dynadot Inc {"raw_response": ...
financial bk8.financial financial United States (US) 188.114.96.1 ["WordPress", "PHP", "Cloudflare"] 0.00000003666 17,407,892.00 2026/02/06 1 {"A": ["188.114.96.1", "188.114.97.1"... 2025/08/22 RDAP 2024/07/24 2026/07/24 2025/08/22 GoDaddy.com, LLC {"raw_response": ...
financial swap.financial financial United States (US) 13.248.155.104 ["Google Tag Manager"] 0.00000003514 13,722,612.00 2026/01/13 1 {"A": ["13.248.155.104", "76.223.27.1... 2025/06/21 RDAP 2020/07/02 2026/07/02 2025/06/21 Amazon Registrar, Inc. {"raw_response": ...
financial breathe.financial financial United States (US) 192.0.78.153 ["NGINX"] 0.00000003400 8,035,357.50 2026/01/29 1 {"A": ["192.0.78.153", "192.0.78.252"... 2025/08/28 RDAP 2024/09/06 2026/09/06 2025/08/28 Automattic Inc. {"raw_response": ...
financial alphacapital.financial financial United States (US) 188.114.96.3 ["Vercel", "Cloudflare"] 0.00000002908 14,427,353.00 2026/01/31 1 {"A": ["188.114.96.3", "188.114.97.3"... 2025/09/30 RDAP 2021/10/29 2025/10/29 2024/01/01 NameCheap, Inc. {"raw_response": ...
financial steakhouse.financial financial United States (US) 216.198.79.193 ["Google Tag Manager"] 0.00000002618 14,285,750.00 2026/01/27 1 {"A": ["216.198.79.193"], "MX": [{"ho... 2025/08/21 RDAP 2022/04/26 2026/04/26 2025/08/21 OVH SAS {"raw_response": ...
financial asa.financial financial United States (US) 13.107.213.53 ["Google Tag Manager", "Apache HTTP S... 0.00000002535 13,542,684.00 2026/01/22 1 {"A": ["13.107.213.53", "13.107.246.5... 2025/09/08 RDAP 2019/09/04 2026/09/04 2025/09/08 GoDaddy.com, LLC {"raw_response": ...
financial vera.financial financial United States (US) 52.36.8.69 ["NGINX"] 0.00000001871 13,522,833.00 2026/02/04 1 {"A": ["52.36.8.69"], "MX": [{"host":... 2026/01/17 RDAP 2021/02/15 2027/02/15 2026/01/17 NameCheap, Inc. {"raw_response": ...
financial crater.financial financial United States (US) 76.76.21.21 ["Nuxt.js", "Vercel"] 0.00000001707 13,225,328.00 2026/01/27 1 {"A": ["76.76.21.21"], "MX": [{"host"... 2025/08/22 RDAP 2022/07/30 2026/07/30 2025/08/22 Squarespace Domains II LLC {"raw_response": ...
financial pando.financial financial France (FR) 217.70.184.38 ["NGINX"] 0.00000001707 12,959,473.00 2026/01/16 1 {"A": ["217.70.184.38"], "MX": [{"hos... 2025/06/27 RDAP 2025/03/12 2026/03/12 2025/06/27 Gandi SAS {"raw_response": ...
financial delta.financial financial United States (US) 188.114.96.1 ["Vercel", "Cloudflare"] 0.00000001614 14,437,776.00 2026/01/26 1 {"A": ["188.114.96.1", "188.114.97.1"... 2025/11/24 RDAP 2020/12/23 2026/12/23 2025/11/24 NameCheap, Inc. {"raw_response": ...
financial premierprivatewealth.financial financial United States (US) 149.28.37.95 ["Google Tag Manager", "Apache HTTP S... 0.00000001543 14,300,108.00 2026/01/27 1 {"A": ["149.28.37.95"], "NS": ["ns64.... 2025/07/13 RDAP 2023/04/26 2026/04/26 2025/07/13 GoDaddy.com, LLC {"raw_response": ...
financial 69vn.financial financial United States (US) 188.114.96.3 ["WordPress", "Cloudflare"] 0.00000001395 13,372,707.00 2026/02/03 1 {"A": ["188.114.96.3", "188.114.97.3"... 2025/06/20 RDAP 2025/04/01 2026/04/01 2025/06/20 Spaceship, Inc. {"raw_response": ...
financial morrison.financial financial United States (US) 198.49.23.145 ["Apache HTTP Server", "WordPress", "... 0.00000001309 6,180,940.50 2026/01/28 1 {"A": ["198.49.23.145"], "MX": [{"hos... 2025/09/09 RDAP 2021/09/16 2025/09/16 2025/09/09 Squarespace Domains II LLC {"raw_response": ...
financial pussy.financial financial United States (US) 76.76.21.21 ["Vercel"] 0.00000001242 13,377,033.00 2026/01/29 1 {"A": ["76.76.21.21"], "MX": [{"host"... 2025/07/10 RDAP 2021/04/20 2026/04/20 2025/07/10 Tucows Domains Inc. {"raw_response": ...
financial mjslot777.financial financial United States (US) 5.161.230.87 ["PHP", "Cloudflare"] 0.00000001234 1.84 2026/02/02 1 {"A": ["5.161.230.87", "46.62.237.138... 2025/09/30 RDAP 2024/10/29 2025/10/29 2024/01/01 NameCheap, Inc. {"raw_response": ...
financial myneo.financial financial United States (US) 18.208.85.101 ["Google Tag Manager", "NGINX", "Clou... 0.00000001216 11,142,270.00 2026/01/27 1 {"A": ["18.208.85.101"], "NS": ["ns1.... 2026/01/15 RDAP 2023/02/13 2027/02/13 2026/01/15 Name.com, Inc. {"raw_response": ...
financial comb.financial financial United States (US) 188.114.96.1 ["Vercel", "Cloudflare"] 0.00000001176 14,275,890.00 2026/01/31 1 {"A": ["188.114.96.1", "188.114.97.1"... 2025/11/09 RDAP 2021/12/08 2026/12/08 2025/11/09 NameCheap, Inc. {"raw_response": ...
financial hercle.financial financial United States (US) 3.164.206.113 ["Google Tag Manager", "Amazon CloudF... 0.00000001130 11,579,572.00 2026/02/14 1 {"A": ["3.164.206.113", "3.164.206.66... 2025/07/27 RDAP 2019/08/07 2026/08/07 2025/07/27 Amazon Registrar, Inc. {"raw_response": ...
financial nic.financial financial United States (US) 75.2.38.108 ["NGINX"] 0.00000001096 14,274,627.00 2026/02/10 1 {"A": ["75.2.38.108", "99.83.155.228"... 2025/06/21 RDAP 2014/03/18 2026/03/18 2025/06/20 Registry Operator acts as Registrar (... {"raw_response": ...
financial clear.financial financial United States (US) 185.230.63.186 ["Wix"] 0.00000001074 2.00 2026/02/04 1 {"A": ["185.230.63.186", "185.230.63.... 2026/02/12 RDAP 2014/08/03 2026/08/03 2026/02/12 Go Canada Domains, LLC {"raw_response": ...

Download full list of .financial domains with tech detailed information

The largest database of live domains and detailed information about them, designed to boost your digital strategies.

.financial domains share by TLD suffix

TLD suffix Count Domain Percentage of TLD suffix
.financial 8,594 99.99
.co.financial 1 0.01

.financial domains share by technologies

Technology Count Domain Percentage of Technology
OpenResty 1,644 24.96
Cloudflare 790 12.00
Google Tag Manager 664 10.08
NGINX 590 8.96
PHP 566 8.59
Apache HTTP Server 561 8.52
AdBlock 352 5.34
WordPress 339 5.15
Google Analytics 194 2.95
Google reCAPTCHA 92 1.40
Envoy Proxy 90 1.37
LiteSpeed Web Server 87 1.32
Akamai 82 1.25
Amazon CloudFront 68 1.03
Squarespace 67 1.02
Facebook 55 0.84
Wix 48 0.73
Microsoft IIS 39 0.59
ASP.NET 34 0.52
Gravatar 33 0.50
Plesk 33 0.50
Vercel 25 0.38
Varnish Cache 23 0.35
WooCommerce 17 0.26
Laravel 16 0.24
Drupal 13 0.20
Google AdSense 8 0.12
LiveChat 7 0.11
Optimizely 6 0.09
Nuxt.js 6 0.09
Mailchimp 5 0.08
Pepyaka 4 0.06
Sucuri 4 0.06
New Relic 3 0.05
Stripe 3 0.05
amazon 2 0.03
Weebly 2 0.03
Lighttpd 2 0.03
Shopify 2 0.03
Sitefinity 2 0.03
TYPO3 2 0.03
Cornerstone OnDemand 1 0.02
Bitrix CMS 1 0.02
Jimdo 1 0.02
Joomla 1 0.02
Piwik (Matomo) 1 0.02
Zend Framework 1 0.02

.financial domains share by countries

Country Count Domain Percentage of Country
United States (US) 5,034 81.01
Germany (DE) 342 5.50
British Virgin Islands (VG) 145 2.33
France (FR) 141 2.27
Canada (CA) 118 1.90
United Kingdom (GB) 107 1.72
Finland (FI) 74 1.19
Australia (AU) 40 0.64
Italy (IT) 39 0.63
Netherlands (NL) 35 0.56
Lithuania (LT) 19 0.31
Japan (JP) 13 0.21
Denmark (DK) 11 0.18
Switzerland (CH) 11 0.18
Singapore (SG) 9 0.14
Ireland (IE) 8 0.13
Austria (AT) 7 0.11
Russia (RU) 7 0.11
Czech Republic (CZ) 5 0.08
Sweden (SE) 5 0.08
Hungary (HU) 4 0.06
Poland (PL) 4 0.06
South Africa (ZA) 4 0.06
Ukraine (UA) 4 0.06
Belgium (BE) 3 0.05
Hong Kong (HK) 3 0.05
Spain (ES) 3 0.05
Brazil (BR) 2 0.03
India (IN) 2 0.03
Luxembourg (LU) 2 0.03
Norway (NO) 2 0.03
Argentina (AR) 1 0.02
Cyprus (CY) 1 0.02
Estonia (EE) 1 0.02
Israel (IL) 1 0.02
Malaysia (MY) 1 0.02
Mexico (MX) 1 0.02
New Zealand (NZ) 1 0.02
Portugal (PT) 1 0.02
Slovakia (SK) 1 0.02
South Korea (KR) 1 0.02
Taiwan (TW) 1 0.02

What is .financial TLD

The .financial top-level domain (TLD) designates online identities focused on finance, banking, investment, and professional advisory services. Within our global index, we track .financial domains and .financial websites to map real-world usage and risk signals. Current activity shows 8,595 active registrations, with 6,225 resolving via DNS and 6,225 live sites delivering content or services. Adoption spans 42 countries, reflecting cross-border relevance for firms and practitioners seeking descriptive, industry-aligned naming. In comparative analyses, .financial provides clear intent signaling and keyword matching without reliance on legacy namespaces, aiding discoverability and categorization. We continuously normalize WHOIS, DNS, and web telemetry to monitor churn, hosting shifts, and compliance footprints. Download .financial domain datasets from webatla.

History and key features of .financial TLD

Introduced under ICANN’s new gTLD program in the mid‑2010s, .financial was designed as a generic, sector-specific namespace rather than a restricted community domain. In practice, .financial domains benefit from semantic precision, while registrants typically apply standard registrar security options such as DNSSEC and privacy, depending on providers. We observe fresh activity signals: 33 new registrations last week and 139 in January 2026, indicating steady but selective growth. Across .financial websites, we analyze naming patterns, host geography, and redirect behavior to quantify brand use versus defensive holdings. This lens helps benchmark availability, lifecycle stages, and consolidation around major platforms. Download time-series .financial domain datasets from webatla.

Why and who choose the .financial domain

Organizations choose .financial to state purpose clearly – banks, insurers, wealth managers, fintech vendors, comparison portals, and specialist publishers. We evaluate who adopts .financial domains by mapping registrant types, corporate linkages, and web stacks, then correlating outcomes across 42 markets. Signals from .financial websites – content responsiveness, TLS posture, and traffic-bearing versus parked states – align with 6,225 live implementations out of 8,595 active records, a practical proxy for utilization. Such clarity helps teams assess naming resonance, portfolio overlap, and migration risk relative to legacy TLDs. These data also surface regional partners and hosting preferences for regulated sectors. Download sector-tagged .financial domain datasets from webatla.

Get the database of all websites in the world

The largest database of live domains and detailed information about them, designed to boost your digital strategies.

FAQ

Can I preview the data?

Yes, you can view examples to see the file format and the amount of information provided. You can download them on the Pricing page, under each package.

All files are provided in CSV format. If you need a different format (XML, JSON, SQL), please contact our support team.

You need to make a purchase on our website. Once the payment is complete, you will receive a download link for the files in your selected package.

We only offer package solutions. You can check out our packages and pricing on the Pricing page.